alpha KGDHC antibody (N-Term)
-
- Target See all alpha KGDHC (alphaKGDHC) Antibodies
- alpha KGDHC (alphaKGDHC) (alpha Ketoglutarate Dehydrogenase (alphaKGDHC))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This alpha KGDHC antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- OGDH antibody was raised against the N terminal of OGDH
- Purification
- Affinity purified
- Immunogen
- OGDH antibody was raised using the N terminal of OGDH corresponding to a region with amino acids MFHLRTCAAKLRPLTASQTVKTFSQNRPAAARTFQQIRCYSAPVAAEPFL
- Top Product
- Discover our top product alphaKGDHC Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
OGDH Blocking Peptide, catalog no. 33R-5994, is also available for use as a blocking control in assays to test for specificity of this OGDH antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OGDH antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- alpha KGDHC (alphaKGDHC) (alpha Ketoglutarate Dehydrogenase (alphaKGDHC))
- Alternative Name
- OGDH (alphaKGDHC Products)
- Background
- The 2-oxoglutarate dehydrogenase complex catalyzes the overall conversion of 2-oxoglutarate to succinyl-CoA and CO2. It contains multiple copies of three enzymatic components: 2-oxoglutarate dehydrogenase (E1), dihydrolipoamide succinyltransferase (E2) and lipoamide dehydrogenase (E3).
- Molecular Weight
- 47 kDa (MW of target protein)
-