ARHGAP25 antibody (Middle Region)

Catalog No. ABIN631594

Product Details anti-ARHGAP25 Antibody

Target: ARHGAP25 (rho GTPase Activating Protein 25 (ARHGAP25))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ARHGAP25 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ARHGAP25 antibody was raised against the middle region of ARHGAP25

Purification: Affinity purified

Immunogen: ARHGAP25 antibody was raised using the middle region of ARHGAP25 corresponding to a region with amino acids SPGEEASALSSQACDSKGDTLASPNSETGPGKKNSGEEEIDSLQRMVQEL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ARHGAP25 Blocking Peptide, catalog no. 33R-8674, is also available for use as a blocking control in assays to test for specificity of this ARHGAP25 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARHGAP25 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ARHGAP25

Target: ARHGAP25 (rho GTPase Activating Protein 25 (ARHGAP25))

Alternative Name: ARHGAP25 (ARHGAP25 Products)

Synonyms: arhgap24 antibody, DKFZp468H165 antibody, KAIA0053 antibody, A130039I20Rik antibody, RGD1562105 antibody, Rho GTPase activating protein 25 antibody, ARHGAP25 antibody, arhgap25 antibody, Arhgap25 antibody

Background: ARHGAPs, such as ARHGAP25, encode negative regulators of Rho GTPases, which are implicated in actin remodeling, cell polarity, and cell migration.

Molecular Weight: 70 kDa (MW of target protein)