-
- Target See all SCYL3 Antibodies
- SCYL3 (SCY1-Like 3 (SCYL3))
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SCYL3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SCYL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MGSENSALKSYTLREPPFTLPSGLAVYPAVLQDGKFASVFVYKRENEDKV
- Top Product
- Discover our top product SCYL3 Primary Antibody
-
anti-SCY1-Like 3 (SCYL3) antibody
SCYL3 Reactivity: Human, Monkey WB, IHC, IHC (p), IF Host: Mouse Monoclonal 4F10 unconjugated
anti-SCY1-Like 3 (SCYL3) (Center) antibodySCYL3 Reactivity: Human WB, IHC (p), IF, ICC Host: Rabbit Polyclonal unconjugated
anti-SCY1-Like 3 (SCYL3) (AA 1-688) antibodySCYL3 Reactivity: Human WB, IF Host: Mouse Polyclonal unconjugated
anti-SCY1-Like 3 (SCYL3) (AA 553-660) antibodySCYL3 Reactivity: Human WB, ELISA Host: Mouse Monoclonal 3D3 unconjugated
anti-SCY1-Like 3 (SCYL3) (AA 1-688) antibodySCYL3 Reactivity: Human WB, IP Host: Rabbit Polyclonal unconjugated
anti-SCY1-Like 3 (SCYL3) (AA 1-688), (C-Term) antibodySCYL3 Reactivity: Human ELISA, IHC Host: Rabbit Polyclonal unconjugated
anti-SCY1-Like 3 (SCYL3) (AA 503-552) antibodySCYL3 Reactivity: Human, Mouse, Rat, Rabbit WB Host: Rabbit Polyclonal unconjugated
anti-SCY1-Like 3 (SCYL3) (N-Term) antibodySCYL3 Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig WB Host: Rabbit Polyclonal unconjugated
anti-SCY1-Like 3 (SCYL3) (N-Term) antibodySCYL3 Reactivity: Human, Mouse, Rat, Rabbit, Guinea Pig, Cow, Dog, Horse WB Host: Rabbit Polyclonal unconjugated
anti-SCY1-Like 3 (SCYL3) (AA 671-699), (C-Term) antibodySCYL3 Reactivity: Mouse WB, IHC (p) Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SCYL3 Blocking Peptide, catalog no. 33R-6074, is also available for use as a blocking control in assays to test for specificity of this SCYL3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCYL3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SCYL3 (SCY1-Like 3 (SCYL3))
- Alternative Name
- SCYL3 (SCYL3 Products)
- Background
- SCYL3 may play a role in regulating cell adhesion/migration complexes in migrating cells.
- Molecular Weight
- 83 kDa (MW of target protein)
-
You are here:
