FAIM antibody (N-Term)

Catalog No. ABIN631583

Product Details anti-FAIM Antibody

Target: FAIM (Fas Apoptotic Inhibitory Molecule (FAIM))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAIM antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FAIM antibody was raised against the N terminal of FAIM

Purification: Affinity purified

Immunogen: FAIM antibody was raised using the N terminal of FAIM corresponding to a region with amino acids MTDLVAVWDVALSDGVHKIEFEHGTTSGKRVVYVDGKEEIRKEWMFKLVG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAIM Blocking Peptide, catalog no. 33R-6537, is also available for use as a blocking control in assays to test for specificity of this FAIM antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAIM antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAIM

Target: FAIM (Fas Apoptotic Inhibitory Molecule (FAIM))

Alternative Name: FAIM (FAIM Products)

Synonyms: FAIM1 antibody, FAIM antibody, faim antibody, zgc:92712 antibody, zgc:92723 antibody, Fas apoptotic inhibitory molecule antibody, Fas apoptotic inhibitory molecule L homeolog antibody, Fas apoptotic inhibitory molecule b antibody, Fas apoptotic inhibitory molecule a antibody, FAIM antibody, Faim antibody, faim antibody, faim.L antibody, Tsp_00038 antibody, faimb antibody, faima antibody

Background: FAIM plays a role as an inducible effector molecule that mediates Fas resistance produced by surface Ig engagement in B cells.

Molecular Weight: 24 kDa (MW of target protein)