GOPC antibody (N-Term)

Catalog No. ABIN631580

Product Details anti-GOPC Antibody

Target: GOPC (Golgi-Associated PDZ and Coiled-Coil Motif Containing (GOPC))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GOPC antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GOPC antibody was raised against the N terminal of GOPC

Purification: Affinity purified

Immunogen: GOPC antibody was raised using the N terminal of GOPC corresponding to a region with amino acids EVLEKEFDKAFVDVDLLLGEIDPDQADITYEGRQKMTSLSSCFAQLCHKA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GOPC Blocking Peptide, catalog no. 33R-2799, is also available for use as a blocking control in assays to test for specificity of this GOPC antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GOPC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GOPC

Target: GOPC (Golgi-Associated PDZ and Coiled-Coil Motif Containing (GOPC))

Alternative Name: GOPC (GOPC Products)

Synonyms: DKFZp459H2130 antibody, 2210402P09Rik antibody, AI844555 antibody, CAL antibody, FIG antibody, GOPC1 antibody, PIST antibody, fe38f01 antibody, wu:fe38f01 antibody, zgc:56254 antibody, zgc:65853 antibody, dJ94G16.2 antibody, cal antibody, gopc1 antibody, pist antibody, golgi associated PDZ and coiled-coil motif containing antibody, golgi-associated PDZ and coiled-coil motif containing antibody, golgi-associated PDZ and coiled-coil motif containing S homeolog antibody, GOPC antibody, Gopc antibody, gopc antibody, gopc.S antibody

Background: GOPC plays a role in intracellular protein trafficking and degradation. GOPC may regulate CFTR chloride currents and acid-induced ACCN3 currents by modulating cell surface expression of both channels. GOPC may also regulate the intracellular trafficking of the ADR1B receptor. GOPC may play a role in autophagy.

Molecular Weight: 50 kDa (MW of target protein)

Pathways: Maintenance of Protein Location, Asymmetric Protein Localization