RPS13 antibody (N-Term)

Catalog No. ABIN631578

Product Details anti-RPS13 Antibody

Target: RPS13 (Ribosomal Protein S13 (RPS13))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RPS13 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RPS13 antibody was raised against the N terminal of RPS13

Purification: Affinity purified

Immunogen: RPS13 antibody was raised using the N terminal of RPS13 corresponding to a region with amino acids MGRMHAPGKGLSQSALPYRRSVPTWLKLTSDDVKEQIYKLAKKGLTPSQI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RPS13 Blocking Peptide, catalog no. 33R-6067, is also available for use as a blocking control in assays to test for specificity of this RPS13 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RPS13

Target: RPS13 (Ribosomal Protein S13 (RPS13))

Alternative Name: RPS13 (RPS13 Products)

Synonyms: S13 antibody, 2700063M04Rik antibody, fb14f11 antibody, fd13f08 antibody, fd60g01 antibody, wu:fb14f11 antibody, wu:fd13f08 antibody, wu:fd60g01 antibody, zgc:91809 antibody, rps13 antibody, ribosomal protein S13 antibody, ribosomal protein13 antibody, 40S ribosomal protein S13 antibody, 30S ribosomal protein S13 antibody, ribosomal protein S13 L homeolog antibody, Rps13 antibody, RPS13 antibody, rps13 antibody, rps-13 antibody, rps13.L antibody

Background: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins.

Molecular Weight: 17 kDa (MW of target protein)