NCAPH2 antibody (N-Term)

Catalog No. ABIN631576

Product Details anti-NCAPH2 Antibody

Target: NCAPH2 (Non-SMC Condensin II Complex, Subunit H2 (NCAPH2))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NCAPH2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NCAPH2 antibody was raised against the N terminal of NCAPH2

Purification: Affinity purified

Immunogen: NCAPH2 antibody was raised using the N terminal of NCAPH2 corresponding to a region with amino acids EYLYSLVYQALDFISGKRRAKQLSSVQEDRANGVASSGVPQEAENEFLSL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NCAPH2 Blocking Peptide, catalog no. 33R-2826, is also available for use as a blocking control in assays to test for specificity of this NCAPH2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NCAPH2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NCAPH2

Target: NCAPH2 (Non-SMC Condensin II Complex, Subunit H2 (NCAPH2))

Alternative Name: NCAPH2 (NCAPH2 Products)

Synonyms: MGC81656 antibody, CAPH2 antibody, si:dkey-202b22.2 antibody, non-SMC condensin II complex subunit H2 antibody, non-SMC condensin II complex subunit H2 L homeolog antibody, non-SMC condensin II complex, subunit H2 antibody, NCAPH2 antibody, ncaph2.L antibody, ncaph2 antibody, Ncaph2 antibody

Background: Condensin complexes I and II play essential roles in mitotic chromosome assembly and segregation. Both condensins contain 2 invariant structural maintenance of chromosome (SMC) subunits, SMC2 and SMC4, but they contain different sets of non-SMC subunits. NCAPH2 is 1 of 3 non-SMC subunits that define condensin II.

Molecular Weight: 68 kDa (MW of target protein)