KLHDC1 antibody (N-Term)
-
- Target See all KLHDC1 Antibodies
- KLHDC1 (Kelch Domain Containing 1 (KLHDC1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KLHDC1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- KLHDC1 antibody was raised against the N terminal of KLHDC1
- Purification
- Affinity purified
- Immunogen
- KLHDC1 antibody was raised using the N terminal of KLHDC1 corresponding to a region with amino acids IDSGLWRMHLMEGELPASMSGSCGACINGKLYIFGGYDDKGYSNRLYFVN
- Top Product
- Discover our top product KLHDC1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KLHDC1 Blocking Peptide, catalog no. 33R-3929, is also available for use as a blocking control in assays to test for specificity of this KLHDC1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHDC1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KLHDC1 (Kelch Domain Containing 1 (KLHDC1))
- Alternative Name
- KLHDC1 (KLHDC1 Products)
- Synonyms
- MST025 antibody, kelch domain containing 1 antibody, KLHDC1 antibody, Klhdc1 antibody
- Background
- KLHDC1 contains 6 Kelch repeats. KLHDC1 and KLHDC2 have differential localization and activity in cultured mammalian cells. The exact function of KLHDC1 remains unknown.
- Molecular Weight
- 47 kDa (MW of target protein)
-