TIGD4 antibody (N-Term)
-
- Target See all TIGD4 Antibodies
- TIGD4 (Tigger Transposable Element Derived 4 (TIGD4))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TIGD4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TIGD4 antibody was raised against the N terminal of TIGD4
- Purification
- Affinity purified
- Immunogen
- TIGD4 antibody was raised using the N terminal of TIGD4 corresponding to a region with amino acids RFDPKRKRLRTAFYTDLEEALMRWYRIAQCLNVPVNGPMLRLKANDFAQK
- Top Product
- Discover our top product TIGD4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TIGD4 Blocking Peptide, catalog no. 33R-7898, is also available for use as a blocking control in assays to test for specificity of this TIGD4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TIGD4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TIGD4 (Tigger Transposable Element Derived 4 (TIGD4))
- Alternative Name
- TIGD4 (TIGD4 Products)
- Background
- The protein encoded by this gene belongs to the tigger subfamily of the pogo superfamily of DNA-mediated transposons in humans. These proteins are related to DNA transposons found in fungi and nematodes, and more distantly to the Tc1 and mariner transposases. They are also very similar to the major mammalian centromere protein B. The exact function of this gene is not known.
- Molecular Weight
- 57 kDa (MW of target protein)
-