IGD1 antibody (Middle Region)
-
- Target
- IGD1 (IGHD@) (Immunoglobulin Heavy Diversity Cluster (IGHD@))
- Binding Specificity
- Middle Region
- Reactivity
- Human
- Host
- Rabbit
- Clonality
- Polyclonal
- Application
- Western Blotting (WB)
- Specificity
- TIGD1 antibody was raised against the middle region of TIGD1
- Purification
- Affinity purified
- Immunogen
- TIGD1 antibody was raised using the middle region of TIGD1 corresponding to a region with amino acids SQLMRKASPMSYFRKLPQPPQPSAATTLTSQQPSTSRQDPPPAKRVRLTE
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TIGD1 Blocking Peptide, catalog no. 33R-8717, is also available for use as a blocking control in assays to test for specificity of this TIGD1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TIGD1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IGD1 (IGHD@) (Immunoglobulin Heavy Diversity Cluster (IGHD@))
- Alternative Name
- IGD1
- Synonyms
- IGH.1@ antibody, IGH@ antibody, IGHDY1 antibody, immunoglobulin heavy locus antibody, IGH antibody
- Background
- TIGD1 belongs to the tigger subfamily of the pogo superfamily of DNA-mediated transposons in humans. These proteins are related to DNA transposons found in fungi and nematodes, and more distantly to the Tc1 and mariner transposases. They are also very similar to the major mammalian centromere protein B. The exact function of this protein is not known.
- Molecular Weight
- 67 kDa (MW of target protein)
-