SLC47A2 antibody (C-Term)

Catalog No. ABIN631558

Product Details anti-SLC47A2 Antibody

Target: SLC47A2 (Solute Carrier Family 47, Member 2 (SLC47A2))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC47A2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SLC47 A2 antibody was raised against the C terminal of SLC47 2

Purification: Affinity purified

Immunogen: SLC47 A2 antibody was raised using the C terminal of SLC47 2 corresponding to a region with amino acids TYSRSECHVDFFRTPEEAHALSAPTSRLSVKQLVIRRGAALGAASATLMV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC47A2 Blocking Peptide, catalog no. 33R-9403, is also available for use as a blocking control in assays to test for specificity of this SLC47A2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC40 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC47A2

Target: SLC47A2 (Solute Carrier Family 47, Member 2 (SLC47A2))

Alternative Name: SLC47A2 (SLC47A2 Products)

Background: SLC47A2 is a protein belonging to a family of transporters involved in excretion of toxic electrolytes, both endogenous and exogenous, through urine and bile. This transporter family shares homology with the bacterial MATE (multidrug and toxin extrusion) protein family responsible for drug resistance.

Molecular Weight: 61 kDa (MW of target protein)