LOC652559 antibody (Middle Region)
-
- Target See all LOC652559 products
- LOC652559
- Binding Specificity
- Middle Region
- Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LOC652559 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- LOC652559 antibody was raised against the middle region of Loc652559
- Purification
- Affinity purified
- Immunogen
- LOC652559 antibody was raised using the middle region of Loc652559 corresponding to a region with amino acids EKSKLGEVDHTLDLVVSFIQEQIVTEEAKSKNSGDAGVDRSLRGPYLARL
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LOC652559 Blocking Peptide, catalog no. 33R-2522, is also available for use as a blocking control in assays to test for specificity of this LOC652559 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LOC652559 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LOC652559
- Alternative Name
- LOC652559 (LOC652559 Products)
- Background
- The sequence of LOC652559 is derived from an annotated genomic sequence (NW_922352) using gene prediction method: GNOMON. The exact function of LOC652559 remains unknown.
- Molecular Weight
- 32 kDa (MW of target protein)
-