NSUN4 antibody (N-Term)

Catalog No. ABIN631550

Product Details anti-NSUN4 Antibody

Target: NSUN4 (NOL1/NOP2/Sun Domain Family, Member 4 (NSUN4))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NSUN4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NSUN4 antibody was raised against the N terminal of NSUN4

Purification: Affinity purified

Immunogen: NSUN4 antibody was raised using the N terminal of NSUN4 corresponding to a region with amino acids QKYGALVNNFAAWDHVSAKLEQLSAKDFVNEAISHWELQSEGGQSAAPSP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NSUN4 Blocking Peptide, catalog no. 33R-7616, is also available for use as a blocking control in assays to test for specificity of this NSUN4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NSUN4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NSUN4

Target: NSUN4 (NOL1/NOP2/Sun Domain Family, Member 4 (NSUN4))

Alternative Name: NSUN4 (NSUN4 Products)

Synonyms: 2310010O12Rik antibody, 2810405F18Rik antibody, AI507900 antibody, Shtap antibody, RP4-603I14.2 antibody, SHTAP antibody, RGD1559652 antibody, NOL1/NOP2/Sun domain family, member 4 antibody, NOP2/Sun RNA methyltransferase family member 4 antibody, NOP2/Sun RNA methyltransferase family member 4 S homeolog antibody, Nsun4 antibody, NSUN4 antibody, nsun4.S antibody

Background: NSUN4 may have S-adenosyl-L-methionine-dependent methyl-transferase activity.

Molecular Weight: 43 kDa (MW of target protein)