RABGGTA antibody (N-Term)

Catalog No. ABIN631549

Product Details anti-RABGGTA Antibody

Target: RABGGTA (Rab Geranylgeranyltransferase, alpha Subunit (RABGGTA))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RABGGTA antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RABGGTA antibody was raised against the N terminal of RABGGTA

Purification: Affinity purified

Immunogen: RABGGTA antibody was raised using the N terminal of RABGGTA corresponding to a region with amino acids ELAFTDSLITRNFSNYSSWHYRSCLLPQLHPQPDSGPQGRLPEDVLLKEL

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RABGGTA Blocking Peptide, catalog no. 33R-2527, is also available for use as a blocking control in assays to test for specificity of this RABGGTA antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RABGGTA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RABGGTA

Target: RABGGTA (Rab Geranylgeranyltransferase, alpha Subunit (RABGGTA))

Alternative Name: RABGGTA (RABGGTA Products)

Synonyms: gm antibody, PTAR3 antibody, Rab geranylgeranyl transferase, a subunit antibody, Rab geranylgeranyltransferase alpha subunit antibody, Rab geranylgeranyltransferase, alpha subunit antibody, Rabggta antibody, RABGGTA antibody

Background: RABGGTA belongs to the protein prenyltransferase subunit alpha family and contains 6 PFTA repeats. RABGGTA catalyzes the transfer of a geranyl-geranyl moiety from geranyl-geranyl pyrophosphate to both cysteines in Rab proteins with an -XXCC, -XCXC and -CCXX C-terminal, such as RAB1A, RAB3A and RAB5A respectively.

Molecular Weight: 65 kDa (MW of target protein)