CDYL2 antibody (N-Term)

Catalog No. ABIN631545

Product Details anti-CDYL2 Antibody

Target: CDYL2 (Chromodomain Protein, Y-Like 2 (CDYL2))

Binding Specificity: N-Term

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CDYL2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CDYL2 antibody was raised against the N terminal of CDYL2

Purification: Affinity purified

Immunogen: CDYL2 antibody was raised using the N terminal of CDYL2 corresponding to a region with amino acids NPPLAKPKKGYSGKPSSGGDRATKTVSYRTTPSGLQIMPLKKSQNGMENG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CDYL2 Blocking Peptide, catalog no. 33R-6826, is also available for use as a blocking control in assays to test for specificity of this CDYL2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDYL2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CDYL2

Target: CDYL2 (Chromodomain Protein, Y-Like 2 (CDYL2))

Alternative Name: CDYL2 (CDYL2 Products)

Synonyms: 1700029M19Rik antibody, 4930453I21Rik antibody, Gm20194 antibody, PCCP1 antibody, chromodomain Y-like 2 antibody, chromodomain Y like 2 antibody, chromodomain protein, Y chromosome-like 2 antibody, CDYL2 antibody, cdyl2 antibody, Cdyl2 antibody

Background: CDYL2 contains 1 chromo domain. The exact function of CDYL2 remains unknown.

Molecular Weight: 56 kDa (MW of target protein)