TTC16 antibody (C-Term)
-
- Target See all TTC16 products
- TTC16 (Tetratricopeptide Repeat Domain 16 (TTC16))
-
Binding Specificity
- C-Term
- Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TTC16 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TTC16 antibody was raised against the C terminal of TTC16
- Purification
- Affinity purified
- Immunogen
- TTC16 antibody was raised using the C terminal of TTC16 corresponding to a region with amino acids RSRGLLRSSTKTEAFYDSNWSLSKTEYAQGQGQRSSKAEGAQGKSQGMSS
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TTC16 Blocking Peptide, catalog no. 33R-8209, is also available for use as a blocking control in assays to test for specificity of this TTC16 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TTC16 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TTC16 (Tetratricopeptide Repeat Domain 16 (TTC16))
- Alternative Name
- TTC16 (TTC16 Products)
- Background
- TTC16 contains 8 TPR repeats. The exact function of TTC16 remains unknown.
- Molecular Weight
- 98 kDa (MW of target protein)
-