NSUN3 antibody (C-Term)

Catalog No. ABIN631537

Product Details anti-NSUN3 Antibody

Target: NSUN3 (NOP2/Sun Domain Family, Member 3 (NSUN3))

Binding Specificity: C-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NSUN3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NSUN3 antibody was raised against the C terminal of NSUN3

Purification: Affinity purified

Immunogen: NSUN3 antibody was raised using the C terminal of NSUN3 corresponding to a region with amino acids LPLLQIELLRSAIKALRPGGILVYSTCTLSKAENQDVISEILNSHGNIMP

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NSUN3 Blocking Peptide, catalog no. 33R-5271, is also available for use as a blocking control in assays to test for specificity of this NSUN3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NSUN3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NSUN3

Target: NSUN3 (NOP2/Sun Domain Family, Member 3 (NSUN3))

Alternative Name: NSUN3 (NSUN3 Products)

Synonyms: 6720484A09Rik antibody, AU022521 antibody, MST077 antibody, im:7142194 antibody, zgc:109983 antibody, NOL1/NOP2/Sun domain family member 3 antibody, NOP2/Sun RNA methyltransferase family member 3 antibody, NOP2/Sun domain family, member 3 antibody, Nsun3 antibody, NSUN3 antibody, nsun3 antibody

Background: NSUN3 may have S-adenosyl-L-methionine-dependent methyl-transferase activity.

Molecular Weight: 38 kDa (MW of target protein)