PPP2R5A antibody (N-Term)
-
- Target See all PPP2R5A Antibodies
- PPP2R5A (Protein Phosphatase 2, Regulatory Subunit B' alpha (PPP2R5A))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PPP2R5A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PPP2 R2 antibody was raised against the N terminal of PPP2 2
- Purification
- Affinity purified
- Immunogen
- PPP2 R2 antibody was raised using the N terminal of PPP2 2 corresponding to a region with amino acids YVSTNRGVIVESAYSDIVKMISANIFRTLPPSDNPDFDPEEDEPTLEASW
- Top Product
- Discover our top product PPP2R5A Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PPP2R5A Blocking Peptide, ABIN936266, is also available for use as a blocking control in assays to test for specificity of this PPP2R5A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PPP2R5A (Protein Phosphatase 2, Regulatory Subunit B' alpha (PPP2R5A))
- Alternative Name
- PPP2R5A (PPP2R5A Products)
- Background
- PPP2R5A belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity.
- Molecular Weight
- 56 kDa (MW of target protein)
- Pathways
- PI3K-Akt Signaling
-