PPP2R5A antibody (N-Term)

Catalog No. ABIN631523

Product Details anti-PPP2R5A Antibody

Target: PPP2R5A (Protein Phosphatase 2, Regulatory Subunit B' alpha (PPP2R5A))

Binding Specificity: N-Term

Reactivity: Mouse, Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PPP2R5A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PPP2 R2 antibody was raised against the N terminal of PPP2 2

Purification: Affinity purified

Immunogen: PPP2 R2 antibody was raised using the N terminal of PPP2 2 corresponding to a region with amino acids YVSTNRGVIVESAYSDIVKMISANIFRTLPPSDNPDFDPEEDEPTLEASW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PPP2R5A Blocking Peptide, ABIN936266, is also available for use as a blocking control in assays to test for specificity of this PPP2R5A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PPP2R5A

Target: PPP2R5A (Protein Phosphatase 2, Regulatory Subunit B' alpha (PPP2R5A))

Alternative Name: PPP2R5A (PPP2R5A Products)

Synonyms: PR61alpha antibody, B56A antibody, PR61A antibody, si:dkey-18c8.1 antibody, protein phosphatase 2 regulatory subunit B'alpha antibody, protein phosphatase 2, regulatory subunit B', alpha antibody, protein phosphatase 2 regulatory subunit B', alpha antibody, protein phosphatase 2, regulatory subunit B', alpha isoform antibody, PPP2R5A antibody, Ppp2r5a antibody, ppp2r5a.S antibody, ppp2r5a antibody

Background: PPP2R5A belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity.

Molecular Weight: 56 kDa (MW of target protein)

Pathways: PI3K-Akt Signaling