KRT23 antibody

Catalog No. ABIN631521

Product Details anti-KRT23 Antibody

Target: KRT23 (Keratin 23 (KRT23))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KRT23 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: Cytokeratin 23 antibody was raised using a synthetic peptide corresponding to a region with amino acids IKTHLEKEITTYRRLLEGESEGTREESKSSMKVSATPKIKAITQETINGR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Cytokeratin 23 Blocking Peptide, catalog no. 33R-4032, is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 23 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRT23 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KRT23

Target: KRT23 (Keratin 23 (KRT23))

Alternative Name: Cytokeratin 23 (KRT23 Products)

Synonyms: CK23 antibody, HAIK1 antibody, K23 antibody, Haik1 antibody, Krt1-23 antibody, Ka23 antibody, keratin 23 antibody, type II keratin 23 antibody, KRT23 antibody, Krt23 antibody, Kb23 antibody

Background: KRT23 is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. The type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains.

Molecular Weight: 48 kDa (MW of target protein)