Cytokeratin 19 antibody (N-Term)

Catalog No. ABIN631520

Product Details anti-Cytokeratin 19 Antibody

Target: Cytokeratin 19 (KRT19) (Keratin 19 (KRT19))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Cytokeratin 19 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Cytokeratin 19 antibody was raised against the N terminal of KRT19

Purification: Affinity purified

Immunogen: Cytokeratin 19 antibody was raised using the N terminal of KRT19 corresponding to a region with amino acids TSYSYRQSSATSSFGGLGGGSVRFGPGVAFRAPSIHGGSGGRGVSVSSAR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Cytokeratin 19 Blocking Peptide, catalog no. 33R-9308, is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 19 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRT19 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Cytokeratin 19

Target: Cytokeratin 19 (KRT19) (Keratin 19 (KRT19))

Alternative Name: Cytokeratin 19 (KRT19 Products)

Synonyms: CK19 antibody, K19 antibody, K1CS antibody, AI663979 antibody, EndoC antibody, Krt-1.19 antibody, Krt1-19 antibody, Ka19 antibody, k19 antibody, ck19 antibody, k1cs antibody, krt9 antibody, krt15 antibody, MGC76282 antibody, GK-19 antibody, MGC83069 antibody, KRT19 antibody, keratin 19 antibody, keratin 19 L homeolog antibody, keratin, type I cytoskeletal 19 antibody, KRT19 antibody, Krt19 antibody, krt19 antibody, krt19.L antibody, LOC100344434 antibody, LOC101117946 antibody

Background: KRT19 is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. The type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. Unlike its related family members, this smallest known acidic cytokeratin is not paired with a basic cytokeratin in epithelial cells. It is specifically expressed in the periderm, the transiently superficial layer that envelopes the developing epidermis.

Molecular Weight: 44 kDa (MW of target protein)