DDT antibody (N-Term)

Catalog No. ABIN631517

Product Details anti-DDT Antibody

Target: DDT (D-Dopachrome Tautomerase (DDT))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DDT antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: DDT antibody was raised against the N terminal of DDT

Purification: Affinity purified

Immunogen: DDT antibody was raised using the N terminal of DDT corresponding to a region with amino acids PFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DDT Blocking Peptide, catalog no. 33R-7078, is also available for use as a blocking control in assays to test for specificity of this DDT antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DDT

Target: DDT (D-Dopachrome Tautomerase (DDT))

Alternative Name: DDT (DDT Products)

Synonyms: ddt-b antibody, zgc:86714 antibody, wu:fb49f11 antibody, C78655 antibody, DDT antibody, ddt antibody, ddt-a antibody, DDCT antibody, D-dopachrome tautomerase L homeolog antibody, D-dopachrome tautomerase antibody, D-dopachrome tautomerase S homeolog antibody, ddt.L antibody, DDT antibody, ddt antibody, Ddt antibody, ddt.S antibody

Background: D-dopachrome tautomerase converts D-dopachrome into 5,6-dihydroxyindole. It is related to the migration inhibitory factor (MIF) in terms of sequence, enzyme activity, and gene structure. DDT and MIF are closely linked on chromosome 22.D-dopachrome tautomerase converts D-dopachrome into 5,6-dihydroxyindole. The DDT gene is related to the migration inhibitory factor (MIF) in terms of sequence, enzyme activity, and gene structure. DDT and MIF are closely linked on chromosome 22.

Molecular Weight: 13 kDa (MW of target protein)