NAT9 antibody

Catalog No. ABIN631510

Product Details anti-NAT9 Antibody

Target: NAT9 (N-Acetyltransferase 9 (NAT9))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NAT9 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: NAT9 antibody was raised using a synthetic peptide corresponding to a region with amino acids MRLNQNTLLLGKKVVLVPYTSEHVPSRYHEWMKSEELQRLTASEPLTLEQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NAT9 Blocking Peptide, catalog no. 33R-6370, is also available for use as a blocking control in assays to test for specificity of this NAT9 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NAT9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NAT9

Target: NAT9 (N-Acetyltransferase 9 (NAT9))

Alternative Name: NAT9 (NAT9 Products)

Synonyms: EBSP, hNATL antibody, 1110028N05Rik antibody, N-acetyltransferase 9 (putative) antibody, N-acetyltransferase 9 (GCN5-related, putative) antibody, NAT9 antibody, Nat9 antibody

Background: N-acetyltransferase 9 is an enzyme that in humans is encoded by the NAT9 gene.

Molecular Weight: 23 kDa (MW of target protein)