BPGM antibody (C-Term)
-
- Target See all BPGM Antibodies
- BPGM (2,3-bisphosphoglycerate Mutase (BPGM))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This BPGM antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- BPGM antibody was raised against the C terminal of BPGM
- Purification
- Affinity purified
- Immunogen
- BPGM antibody was raised using the C terminal of BPGM corresponding to a region with amino acids LPTGVPILLELDENLRAVGPHQFLGDQEAIQAAIKKVEDQGKVKQAKK
- Top Product
- Discover our top product BPGM Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
BPGM Blocking Peptide, catalog no. 33R-5292, is also available for use as a blocking control in assays to test for specificity of this BPGM antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BPGM antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- BPGM (2,3-bisphosphoglycerate Mutase (BPGM))
- Alternative Name
- BPGM (BPGM Products)
- Synonyms
- DPGM antibody, AI323730 antibody, AL022789 antibody, C86192 antibody, Ab2-098 antibody, zgc:92230 antibody, Bisphosphoglycerate mutase antibody, bisphosphoglycerate mutase antibody, 2,3-bisphosphoglycerate mutase antibody, bisphosphoglycerate mutase S homeolog antibody, pmge antibody, BPGM antibody, Bpgm antibody, bpgm antibody, bpgm.S antibody
- Background
- BPGM belongs to the phosphoglycerate mutase family, BPG-dependent PGAM subfamily. It plays a major role in regulating hemoglobin oxygen affinity as a consequence of controlling 2,3-BPG concentration. It can also catalyze the reaction of EC 5.4.2.1 (mutase) and EC 3.1.3.13 (phosphatase), but with a reduced activity.
- Molecular Weight
- 28 kDa (MW of target protein)
-