GID4 antibody (C-Term)

Catalog No. ABIN631498

Product Details anti-GID4 Antibody

Target: GID4 (GID Complex Subunit 4, VID24 Homolog (GID4))

Binding Specificity: C-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GID4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C17 ORF39 antibody was raised against the C terminal Of C17 rf39

Purification: Affinity purified

Immunogen: C17 ORF39 antibody was raised using the C terminal Of C17 rf39 corresponding to a region with amino acids WDADEDVDRKHWGKFLAFYQYAKSFNSDDFDYEELKNGDYVFMRWKEQFL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C17ORF39 Blocking Peptide, catalog no. 33R-9936, is also available for use as a blocking control in assays to test for specificity of this C17ORF39 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF39 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GID4

Target: GID4 (GID Complex Subunit 4, VID24 Homolog (GID4))

Alternative Name: C17ORF39 (GID4 Products)

Synonyms: C17orf39 antibody, VID24 antibody, 4933439F18Rik antibody, GID complex subunit 4 homolog antibody, GID complex subunit 4, VID24 homolog antibody, GID4 antibody, Gid4 antibody

Background: The function of C17orf39 protein has not been widely studied, and is yet to be fully elucidated. The multiprotein Mediator complex is a coactivator required for activation of RNA polymerase II transcription by DNA bound transcription factors.

Molecular Weight: 33 kDa (MW of target protein)