TUBA4A antibody (Middle Region)
-
- Target See all TUBA4A Antibodies
- TUBA4A (Tubulin, alpha 4a (TUBA4A))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat, Drosophila melanogaster, Arabidopsis, C. elegans
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TUBA4A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Alpha Tubulin 4 A antibody was raised against the middle region of TUBA4
- Purification
- Affinity purified
- Immunogen
- alpha Tubulin 4 A antibody was raised using the middle region of TUBA4 corresponding to a region with amino acids GGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTH
- Top Product
- Discover our top product TUBA4A Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
alpha Tubulin 4A Blocking Peptide, catalog no. 33R-3301, is also available for use as a blocking control in assays to test for specificity of this alpha Tubulin 4A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TUBA0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TUBA4A (Tubulin, alpha 4a (TUBA4A))
- Alternative Name
- alpha Tubulin 4A (TUBA4A Products)
- Synonyms
- TUBA1 antibody, TUBA6 antibody, H2-ALPHA antibody, M[a]4 antibody, Tuba4 antibody, tuba1 antibody, tubulin alpha 1a antibody, tubulin alpha 4a antibody, tubulin, alpha 4A antibody, tubulin alpha 4a L homeolog antibody, TUBA1A antibody, TUBA4A antibody, Tuba4a antibody, tuba4a.L antibody
- Background
- Microtubules of the eukaryotic cytoskeleton perform essential and diverse functions and are composed of a heterodimer of alpha and beta tubulin. The genes encoding these microtubule constituents are part of the tubulin superfamily.
- Molecular Weight
- 50 kDa (MW of target protein)
- Pathways
- Microtubule Dynamics, M Phase
-