beta Tubulin 2A (N-Term) antibody
-
- Target
- beta Tubulin 2A
- Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- Un-conjugated
- Application
- Western Blotting (WB)
- Specificity
- Beta Tubulin 2 A antibody was raised against the N terminal of TUBB2
- Purification
- Affinity purified
- Immunogen
- Beta Tubulin 2 A antibody was raised using the N terminal of TUBB2 corresponding to a region with amino acids MAKRSRSEDEDDDLQYADHDYEVPQQKGLKKLWNRVKWTRDEDDKLKKLV
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Beta Tubulin 2A Blocking Peptide, catalog no. 33R-5679, is also available for use as a blocking control in assays to test for specificity of this Beta Tubulin 2A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TUBB0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- beta Tubulin 2A
- Background
- TUBB2A belongs to the tubulin family. Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain.
- Molecular Weight
- 50 kDa (MW of target protein)
-