beta Tubulin 2A (Middle Region) antibody

Catalog No. ABIN631482

Product Details

Target: beta Tubulin 2A

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat, Arabidopsis, Drosophila melanogaster

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Specificity: Beta Tubulin 2 A antibody was raised against the middle region of TUBB2

Purification: Affinity purified

Immunogen: Beta Tubulin 2 A antibody was raised using the middle region of TUBB2 corresponding to a region with amino acids AVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAAC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Beta Tubulin 2A Blocking Peptide, catalog no. 33R-1609, is also available for use as a blocking control in assays to test for specificity of this Beta Tubulin 2A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TUBB0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: beta Tubulin 2A

Background: TUBB2A belongs to the tubulin family. Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain.

Molecular Weight: 49 kDa (MW of target protein)