LAP3 antibody (N-Term)

Catalog No. ABIN631475

Product Details anti-LAP3 Antibody

Target: LAP3 (Cytosol Aminopeptidase (LAP3))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LAP3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LAP3 antibody was raised against the N terminal of LAP3

Purification: Affinity purified

Immunogen: LAP3 antibody was raised using the N terminal of LAP3 corresponding to a region with amino acids LNISGPPLKAGKTRTFYGLHQDFPSVVLVGLGKKAAGIDEQENWHEGKEN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LAP3 Blocking Peptide, catalog no. 33R-5225, is also available for use as a blocking control in assays to test for specificity of this LAP3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LAP3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LAP3

Target: LAP3 (Cytosol Aminopeptidase (LAP3))

Alternative Name: LAP3 (LAP3 Products)

Synonyms: LAP antibody, LAPEP antibody, PEPS antibody, 2410015L10Rik antibody, AA410100 antibody, LAP-3 antibody, Lap antibody, Lapep antibody, Pep-7 antibody, Pep-S antibody, Pep7 antibody, Peps antibody, cytosol aminopeptidase antibody, leucine aminopeptidase 3 antibody, pepA antibody, Plabr_1567 antibody, Dester_0800 antibody, Weevi_0186 antibody, Marky_0570 antibody, Halhy_2623 antibody, FsymDg_3217 antibody, Flexsi_2186 antibody, Runsl_3980 antibody, lap3 antibody, LAP3 antibody, Lap3 antibody

Background: LAP3 is presumably involved in the processing and regular turnover of intracellular proteins. LAP3 catalyzes the removal of unsubstituted N-terminal amino acids from various peptides.

Molecular Weight: 56 kDa (MW of target protein)