MYO1E antibody (Middle Region)
-
- Target See all MYO1E Antibodies
- MYO1E (Myosin IE (MYO1E))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MYO1E antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Myosin Ie antibody was raised against the middle region of MYO1 E
- Purification
- Affinity purified
- Immunogen
- Myosin Ie antibody was raised using the middle region of MYO1 E corresponding to a region with amino acids PKPQPKPKPQVPQCKALYAYDAQDTDELSFNANDIIDIIKEDPSGWWTGR
- Top Product
- Discover our top product MYO1E Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Myosin Ie Blocking Peptide, catalog no. 33R-7176, is also available for use as a blocking control in assays to test for specificity of this Myosin Ie antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MYO0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MYO1E (Myosin IE (MYO1E))
- Alternative Name
- Myosin Ie (MYO1E Products)
- Synonyms
- FSGS6 antibody, HuncM-IC antibody, MYO1C antibody, MYR5 antibody, Myr3 antibody, 2310020N23Rik antibody, 9130023P14Rik antibody, AA407778 antibody, myosin-1e antibody, myr 3 antibody, myo1e antibody, wu:fc15g04 antibody, wu:fe49h01 antibody, myosin IE antibody, myosin IE, a antibody, MYO1E antibody, Myo1e antibody, myo1ea antibody
- Background
- Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. Their highly divergent tails are presumed to bind to membranous compartments, which would be moved relative to actin filaments.
- Molecular Weight
- 127 kDa (MW of target protein)
- Pathways
- Platelet-derived growth Factor Receptor Signaling
-