COG2 antibody (N-Term)
-
- Target See all COG2 Antibodies
- COG2 (Conserved oligomeric Golgi complex subunit 2 (COG2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This COG2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- COG2 antibody was raised against the N terminal of COG2
- Purification
- Affinity purified
- Immunogen
- COG2 antibody was raised using the N terminal of COG2 corresponding to a region with amino acids KRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGMDKALNQ
- Top Product
- Discover our top product COG2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
COG2 Blocking Peptide, catalog no. 33R-4640, is also available for use as a blocking control in assays to test for specificity of this COG2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COG2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- COG2 (Conserved oligomeric Golgi complex subunit 2 (COG2))
- Alternative Name
- COG2 (COG2 Products)
- Background
- Multiprotein complexes are key determinants of Golgi apparatus structure and its capacity for intracellular transport and glycoprotein modification. Several complexes have been identified, including the Golgi transport complex (GTC), the LDLC complex, which is involved in glycosylation reactions, and the SEC34 complex, which is involved in vesicular transport. These 3 complexes are identical and have been termed the conserved oligomeric Golgi (COG) complex, which includes COG2.
- Molecular Weight
- 83 kDa (MW of target protein)
-