METAP2 antibody (N-Term)

Catalog No. ABIN631470

Product Details anti-METAP2 Antibody

Target: METAP2 (Methionyl Aminopeptidase 2 (METAP2))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This METAP2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: METAP2 antibody was raised against the N terminal of METAP2

Purification: Affinity purified

Immunogen: METAP2 antibody was raised using the N terminal of METAP2 corresponding to a region with amino acids ATGKKKKKKKKKRGPKVQTDPPSVPICDLYPNGVFPKGQECEYPPTQDGR

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

METAP2 Blocking Peptide, catalog no. 33R-1556, is also available for use as a blocking control in assays to test for specificity of this METAP2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of METAP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for METAP2

Target: METAP2 (Methionyl Aminopeptidase 2 (METAP2))

Alternative Name: METAP2 (METAP2 Products)

Synonyms: metap2 antibody, MGC53792 antibody, METAP2 antibody, GB13458 antibody, DDBDRAFT_0190923 antibody, DDBDRAFT_0304991 antibody, DDB_0190923 antibody, DDB_0304991 antibody, 4930584B20Rik antibody, A930035J23Rik antibody, AI047573 antibody, AL024412 antibody, AU014659 antibody, Amp2 antibody, Mnpep antibody, p67 antibody, p67eIF2 antibody, MAP2 antibody, MNPEP antibody, wu:fb98h06 antibody, zgc:66250 antibody, methionyl aminopeptidase 2 L homeolog antibody, methionyl aminopeptidase 2 antibody, methionine aminopeptidase 2 antibody, methionine aminopeptidase antibody, methionyl aminopeptidase 2 S homeolog antibody, methionyl aminopeptidase 2b antibody, metap2.L antibody, METAP2 antibody, metap2 antibody, LOC551771 antibody, CAALFM_C604080WA antibody, Metap2 antibody, metap2.S antibody, metap2b antibody

Background: METAP2 is a member of the methionyl aminopeptidase family and encodes a protein that binds 2 cobalt or manganese ions. This protein functions both by protecting the alpha subunit of eukaryotic initiation factor 2 from inhibitory phosphorylation and by removing the amino-terminal methionine residue from nascent protein. Increased expression of this gene is associated with various forms of cancer and the anti-cancer drugs fumagillin and ovalicin inhibit the protein by irreversibly binding to its active site.

Molecular Weight: 53 kDa (MW of target protein)

Pathways: Regulation of G-Protein Coupled Receptor Protein Signaling