METAP2 antibody (N-Term)
-
- Target See all METAP2 Antibodies
- METAP2 (Methionyl Aminopeptidase 2 (METAP2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This METAP2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- METAP2 antibody was raised against the N terminal of METAP2
- Purification
- Affinity purified
- Immunogen
- METAP2 antibody was raised using the N terminal of METAP2 corresponding to a region with amino acids ATGKKKKKKKKKRGPKVQTDPPSVPICDLYPNGVFPKGQECEYPPTQDGR
- Top Product
- Discover our top product METAP2 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
METAP2 Blocking Peptide, catalog no. 33R-1556, is also available for use as a blocking control in assays to test for specificity of this METAP2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of METAP2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- METAP2 (Methionyl Aminopeptidase 2 (METAP2))
- Alternative Name
- METAP2 (METAP2 Products)
- Background
- METAP2 is a member of the methionyl aminopeptidase family and encodes a protein that binds 2 cobalt or manganese ions. This protein functions both by protecting the alpha subunit of eukaryotic initiation factor 2 from inhibitory phosphorylation and by removing the amino-terminal methionine residue from nascent protein. Increased expression of this gene is associated with various forms of cancer and the anti-cancer drugs fumagillin and ovalicin inhibit the protein by irreversibly binding to its active site.
- Molecular Weight
- 53 kDa (MW of target protein)
- Pathways
- Regulation of G-Protein Coupled Receptor Protein Signaling
-