OSBPL3 antibody (N-Term)

Catalog No. ABIN631463

Product Details anti-OSBPL3 Antibody

Target: OSBPL3 (Oxysterol Binding Protein-Like 3 (OSBPL3))

Binding Specificity: N-Term

Reactivity: Mouse, Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This OSBPL3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: OSBPL3 antibody was raised against the N terminal of OSBPL3

Purification: Affinity purified

Immunogen: OSBPL3 antibody was raised using the N terminal of OSBPL3 corresponding to a region with amino acids MMSDEKNLGVSQKLVSPSRSTSSCSSKQGSRQDSWEVVEGLRGEMNYTQE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

OSBPL3 Blocking Peptide, catalog no. 33R-6237, is also available for use as a blocking control in assays to test for specificity of this OSBPL3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OSBPL3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for OSBPL3

Target: OSBPL3 (Oxysterol Binding Protein-Like 3 (OSBPL3))

Alternative Name: OSBPL3 (OSBPL3 Products)

Synonyms: osbpl3 antibody, zgc:101089 antibody, OSBPL3 antibody, ORP-3 antibody, ORP3 antibody, OSBP3 antibody, 1200014M06Rik antibody, 6720421I08Rik antibody, A530055M08 antibody, RGD1564287 antibody, oxysterol binding protein like 3 antibody, oxysterol binding protein-like 3a antibody, oxysterol binding protein-like 3 antibody, OSBPL3 antibody, osbpl3a antibody, osbpl3 antibody, Osbpl3 antibody

Background: This gene encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Most members contain an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain. Several transcript variants encoding different isoforms have been identified.

Molecular Weight: 98 kDa (MW of target protein)