SCGN antibody (Middle Region)
-
- Target See all SCGN Antibodies
- SCGN (Secretagogin, EF-Hand Calcium Binding Protein (SCGN))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SCGN antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SCGN antibody was raised against the middle region of SCGN
- Purification
- Affinity purified
- Immunogen
- SCGN antibody was raised using the middle region of SCGN corresponding to a region with amino acids KDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCLGLKINP
- Top Product
- Discover our top product SCGN Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SCGN Blocking Peptide, catalog no. 33R-4296, is also available for use as a blocking control in assays to test for specificity of this SCGN antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCGN antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SCGN (Secretagogin, EF-Hand Calcium Binding Protein (SCGN))
- Alternative Name
- SCGN (SCGN Products)
- Synonyms
- SCGN antibody, MGC146683 antibody, CALBL antibody, DJ501N12.8 antibody, SECRET antibody, SEGN antibody, setagin antibody, zgc:100843 antibody, secretagogin, EF-hand calcium binding protein antibody, Secretagogin antibody, secretagogin, EF-hand calcium binding protein L homeolog antibody, SCGN antibody, scgn antibody, segn antibody, scgn.L antibody, Scgn antibody
- Background
- SCGN is a secreted calcium-binding protein which is found in the cytoplasm. It is related to calbindin D-28K and calretinin. This protein is thought to be involved in KCL-stimulated calcium flux and cell proliferation.
- Molecular Weight
- 32 kDa (MW of target protein)
-