BLMH antibody (Middle Region)
-
- Target See all BLMH Antibodies
- BLMH (Bleomycin Hydrolase (BLMH))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This BLMH antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- BLMH antibody was raised against the middle region of BLMH
- Purification
- Affinity purified
- Immunogen
- BLMH antibody was raised using the middle region of BLMH corresponding to a region with amino acids EYLSNMVGGRKTLYNNQPIDFLKKMVAASIKDGEAVWFGCDVGKHFNSKL
- Top Product
- Discover our top product BLMH Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
BLMH Blocking Peptide, catalog no. 33R-2825, is also available for use as a blocking control in assays to test for specificity of this BLMH antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BLMH antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- BLMH (Bleomycin Hydrolase (BLMH))
- Alternative Name
- BLMH (BLMH Products)
- Synonyms
- AI035728 antibody, Bh antibody, Bmh antibody, wu:fb13c01 antibody, zgc:66261 antibody, bh antibody, bmh antibody, BH antibody, BMH antibody, bleomycin hydrolase antibody, Bleomycin hydrolase antibody, bleomycin hydrolase S homeolog antibody, BLMH antibody, pepC antibody, LOC5569945 antibody, Apre_0140 antibody, Apar_0899 antibody, Smon_1289 antibody, Kfla_1242 antibody, Snas_3912 antibody, BLJ_1941 antibody, Olsu_1085 antibody, PGTDC60_0106 antibody, Blmh antibody, blmh antibody, blmh.S antibody
- Background
- The normal physiological role of BLM hydrolase is unknown, but it catalyzes the inactivation of the antitumor drug BLM (a glycopeptide) by hydrolyzing the carboxamide bond of its B-aminoalaninamide moiety thus protecting normal and malignant cells from BLM toxicity.
- Molecular Weight
- 52 kDa (MW of target protein)
-