GALE antibody (N-Term)

Catalog No. ABIN631451

Product Details anti-GALE Antibody

Target: GALE (UDP-Galactose-4-Epimerase (GALE))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GALE antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GALE antibody was raised against the N terminal of GALE

Purification: Affinity purified

Immunogen: GALE antibody was raised using the N terminal of GALE corresponding to a region with amino acids AEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GALE Blocking Peptide, catalog no. 33R-1135, is also available for use as a blocking control in assays to test for specificity of this GALE antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GALE antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GALE

Target: GALE (UDP-Galactose-4-Epimerase (GALE))

Alternative Name: GALE (GALE Products)

Synonyms: GALE antibody, im:7147391 antibody, wu:fb05f01 antibody, zgc:136578 antibody, F15H21.11 antibody, F15H21_11 antibody, REB1 antibody, ROOT EPIDERMAL BULGER1 antibody, ROOT HAIR DEFECTIVE 1 antibody, UDP-GLUCOSE 4-EPIMERASE antibody, UGE4 antibody, ECK0748 antibody, galD antibody, JW0742 antibody, SMU.888 antibody, BA5505 antibody, BA5700 antibody, VFA0352 antibody, galE antibody, 2310002A12Rik antibody, AI323962 antibody, 1n569 antibody, xgale antibody, SDR1E1 antibody, UDP-galactose-4-epimerase antibody, NAD(P)-binding Rossmann-fold superfamily protein antibody, UDP-galactose 4-epimerase GalE antibody, UDP-glucose 4-epimerase antibody, UDP-glucose 4-epimerase GalE antibody, UDP-glucose/UDP-N-acetylglucosamine 4-epimerase antibody, galactose-4-epimerase, UDP antibody, UDP-galactose-4-epimerase L homeolog antibody, GALE antibody, gale antibody, RHD1 antibody, ECs0787 antibody, galE antibody, galE1 antibody, galE2 antibody, STY0809 antibody, galE-2 antibody, SG0897 antibody, galD antibody, Ent638_1250 antibody, Gale antibody, gale.L antibody

Background: GALE is an UDP-galactose-4-epimerase which catalyzes two distinct but analogous reactions: the epimerization of UDP-glucose to UDP-galactose, and the epimerization of UDP-N-acetylglucosamine to UDP-N-acetylgalactosamine. The bifunctional nature of the enzyme has the important metabolic consequence that mutant cells (or individuals) are dependent not only on exogenous galactose, but also on exogenous N-acetylgalactosamine as a necessary precursor for the synthesis of glycoproteins and glycolipids. Mutations in this gene result in epimerase-deficiency galactosemia, also referred to as galactosemia type 3, a disease characterized by liver damage, early-onset cataracts, deafness and mental retardation.

Molecular Weight: 38 kDa (MW of target protein)

Pathways: Response to Water Deprivation, Cellular Glucan Metabolic Process