GALE antibody (N-Term)
-
- Target See all GALE Antibodies
- GALE (UDP-Galactose-4-Epimerase (GALE))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GALE antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GALE antibody was raised against the N terminal of GALE
- Purification
- Affinity purified
- Immunogen
- GALE antibody was raised using the N terminal of GALE corresponding to a region with amino acids AEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRR
- Top Product
- Discover our top product GALE Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GALE Blocking Peptide, catalog no. 33R-1135, is also available for use as a blocking control in assays to test for specificity of this GALE antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GALE antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GALE (UDP-Galactose-4-Epimerase (GALE))
- Alternative Name
- GALE (GALE Products)
- Background
- GALE is an UDP-galactose-4-epimerase which catalyzes two distinct but analogous reactions: the epimerization of UDP-glucose to UDP-galactose, and the epimerization of UDP-N-acetylglucosamine to UDP-N-acetylgalactosamine. The bifunctional nature of the enzyme has the important metabolic consequence that mutant cells (or individuals) are dependent not only on exogenous galactose, but also on exogenous N-acetylgalactosamine as a necessary precursor for the synthesis of glycoproteins and glycolipids. Mutations in this gene result in epimerase-deficiency galactosemia, also referred to as galactosemia type 3, a disease characterized by liver damage, early-onset cataracts, deafness and mental retardation.
- Molecular Weight
- 38 kDa (MW of target protein)
- Pathways
- Response to Water Deprivation, Cellular Glucan Metabolic Process
-