ALG2 antibody

Catalog No. ABIN631449

Product Details anti-ALG2 Antibody

Target: ALG2 (Asparagine-Linked Glycosylation 2, alpha-1,3-Mannosyltransferase Homolog (ALG2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ALG2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: ALG2 antibody was raised using a synthetic peptide corresponding to a region with amino acids QSDLGQYVTFLRSFSDKQKISLLHSCTCVLYTPSNEHFGIVPLEAMYMQC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ALG2 Blocking Peptide, catalog no. 33R-7721, is also available for use as a blocking control in assays to test for specificity of this ALG2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALG2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ALG2

Target: ALG2 (Asparagine-Linked Glycosylation 2, alpha-1,3-Mannosyltransferase Homolog (ALG2))

Alternative Name: ALG2 (ALG2 Products)

Synonyms: CDGIi antibody, NET38 antibody, hALPG2 antibody, 1110018A23Rik antibody, 1300013N08Rik antibody, ALPG2 antibody, MNCb-5081 antibody, im:7145131 antibody, ALG2, alpha-1,3/1,6-mannosyltransferase antibody, asparagine-linked glycosylation 2 (alpha-1,3-mannosyltransferase) antibody, ALG2, alpha-1,3/1,6-mannosyltransferase L homeolog antibody, GDP-Man:Man(1)GlcNAc(2)-PP-dolichol alpha-1,3-mannosyltransferase antibody, ALG2 antibody, Alg2 antibody, alg2.L antibody, alg2 antibody

Background: ALG2 is a member of the glycosyltransferase 1 family. It acts as an alpha 1,3 mannosyltransferase, mannosylating Man(2)GlcNAc(2)-dolichol diphosphate and Man(1)GlcNAc(2)-dolichol diphosphate to form Man(3)GlcNAc(2)-dolichol diphosphate. Defects in this gene have been associated with congenital disorder of glycosylation type Ih (CDG-Ii).

Molecular Weight: 47 kDa (MW of target protein)