Glycogen Synthase 2 antibody
-
- Target See all Glycogen Synthase 2 (GYS2) Antibodies
- Glycogen Synthase 2 (GYS2) (Glycogen Synthase 2, Liver (GYS2))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Glycogen Synthase 2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- Glycogen Synthase 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TLSRAFPDKFHVELTSPPTTEGFKYPRPSSVPPSPSGSQASSPQSSDVED
- Top Product
- Discover our top product GYS2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Glycogen Synthase 2 Blocking Peptide, catalog no. 33R-9185, is also available for use as a blocking control in assays to test for specificity of this Glycogen Synthase 2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GYS2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Glycogen Synthase 2 (GYS2) (Glycogen Synthase 2, Liver (GYS2))
- Alternative Name
- Glycogen Synthase 2 (GYS2 Products)
- Background
- GYS2 transfers the glycosyl residue from UDP-Glc to the non-reducing end of alpha-1,4-glucan.
- Molecular Weight
- 81 kDa (MW of target protein)
- Pathways
- AMPK Signaling, Cellular Glucan Metabolic Process
-