ASL antibody (N-Term)
-
- Target See all ASL Antibodies
- ASL (Argininosuccinate Lyase (ASL))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ASL antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ASL antibody was raised against the N terminal of ASL
- Purification
- Affinity purified
- Immunogen
- ASL antibody was raised using the N terminal of ASL corresponding to a region with amino acids GATAGKLHTGRSRNDQVVTDLRLWMRQTCSTLSGLLWELIRTMVDRAEAE
- Top Product
- Discover our top product ASL Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ASL Blocking Peptide, catalog no. 33R-3175, is also available for use as a blocking control in assays to test for specificity of this ASL antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASL antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ASL (Argininosuccinate Lyase (ASL))
- Alternative Name
- ASL (ASL Products)
- Background
- ASL is a member of the lyase 1 family. The protein forms a cytosolic homotetramer and primarily catalyzes the reversible hydrolytic cleavage of argininosuccinate into arginine and fumarate, an essential step in the liver in detoxifying ammonia via the urea cycle. Mutations in its gene result in the autosomal recessive disorder argininosuccinic aciduria, or argininosuccinic acid lyase deficiency.
- Molecular Weight
- 52 kDa (MW of target protein)
- Pathways
- Response to Growth Hormone Stimulus
-