PDS5B antibody
-
- Target See all PDS5B Antibodies
- PDS5B (PDS5, Regulator of Cohesion Maintenance, Homolog B (PDS5B))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PDS5B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- PDS5 B antibody was raised using a synthetic peptide corresponding to a region with amino acids DEQQWPEEKRLKEDILENEDEQNSPPKKGKRGRPPKPLGGGTPKEEPTMK
- Top Product
- Discover our top product PDS5B Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PDS5B Blocking Peptide, catalog no. 33R-1917, is also available for use as a blocking control in assays to test for specificity of this PDS5B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDS0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PDS5B (PDS5, Regulator of Cohesion Maintenance, Homolog B (PDS5B))
- Alternative Name
- PDS5B (PDS5B Products)
- Synonyms
- APRIN antibody, AS3 antibody, CG008 antibody, Aprin antibody, as3 antibody, aprin antibody, AI646570 antibody, AW212954 antibody, mKIAA0979 antibody, pds5b antibody, PDS5 cohesin associated factor B antibody, PDS5 cohesin associated factor B L homeolog antibody, PDS5B antibody, Pds5b antibody, pds5b antibody, pds5b.L antibody
- Background
- PDS5B plays a role in androgen-induced proliferative arrest in prostate cells. It is required for maintenance of sister chromatid cohesion during mitosis. Defects in PDS5B may be the cause of some cancers including esophageal cancer.
- Molecular Weight
- 159 kDa (MW of target protein)
-