RAB1A antibody (Middle Region)

Catalog No. ABIN631433

Product Details anti-RAB1A Antibody

Target: RAB1A (RAB1A, Member RAS Oncogene Family (RAB1A))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RAB1A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RAB1 A antibody was raised against the middle region of RAB1

Purification: Affinity purified

Immunogen: RAB1 A antibody was raised using the middle region of RAB1 corresponding to a region with amino acids AKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RAB1A Blocking Peptide, catalog no. 33R-1303, is also available for use as a blocking control in assays to test for specificity of this RAB1A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RAB1A

Target: RAB1A (RAB1A, Member RAS Oncogene Family (RAB1A))

Alternative Name: RAB1A (RAB1A Products)

Background: This gene encodes a member of the Ras superfamily of GTPases. Members of the gene family cycle between inactive GDP-bound and active GTP-bound forms.

Molecular Weight: 23 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome