RAB1A antibody (Middle Region)

Catalog No. ABIN631433

Product Details anti-RAB1A Antibody

Target: RAB1A (RAB1A, Member RAS Oncogene Family (RAB1A))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RAB1A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RAB1 A antibody was raised against the middle region of RAB1

Purification: Affinity purified

Immunogen: RAB1 A antibody was raised using the middle region of RAB1 corresponding to a region with amino acids AKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RAB1A Blocking Peptide, catalog no. 33R-1303, is also available for use as a blocking control in assays to test for specificity of this RAB1A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RAB1A

Target: RAB1A (RAB1A, Member RAS Oncogene Family (RAB1A))

Alternative Name: RAB1A (RAB1A Products)

Synonyms: RAB1 antibody, YPT1 antibody, RAS antibody, RAB1B antibody, fb53a02 antibody, oncogene antibody, wu:fb53a02 antibody, si:zc101n13.3 antibody, rab1 antibody, MGC53138 antibody, RAB1A antibody, AAF55873 antibody, CG3320 antibody, DRAB1 antibody, DRab1 antibody, Dm Rab1 antibody, DmRab1 antibody, Dmel\\CG3320 antibody, RAB1a antibody, Rab1a antibody, dRab1 antibody, dar6 antibody, drab1 antibody, DDBDRAFT_0185730 antibody, DDBDRAFT_0191476 antibody, DDB_0185730 antibody, DDB_0191476 antibody, Gtbp antibody, Rab-1 antibody, Rab1A antibody, Ypt1 antibody, mKIAA3012 antibody, Ac2-048 antibody, Rab1 antibody, Rab1r antibody, RAB1A, member RAS oncogene family antibody, RAB1A, member RAS oncogene family b antibody, RAB1A, member RAS oncogene family L homeolog antibody, RAB1B, member RAS oncogene family antibody, CG3320 gene product from transcript CG3320-RA antibody, rab1A protein antibody, PfRab1a antibody, hypothetical protein antibody, Rab GTPase antibody, angiogenin antibody, RAB1A antibody, rab1ab antibody, rab1a.L antibody, RAB1B antibody, rab1a antibody, Rab1 antibody, rab1A antibody, Rab1a antibody, ANG antibody

Background: This gene encodes a member of the Ras superfamily of GTPases. Members of the gene family cycle between inactive GDP-bound and active GTP-bound forms.

Molecular Weight: 23 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome