Sec8 antibody (N-Term)

Catalog No. ABIN631432

Product Details anti-Sec8 Antibody

Target: Sec8 (EXOC4) (Exocyst Complex Component 4 (EXOC4))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Sec8 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: EXOC4 antibody was raised against the N terminal of EXOC4

Purification: Affinity purified

Immunogen: EXOC4 antibody was raised using the N terminal of EXOC4 corresponding to a region with amino acids MAAEAAGGKYRSTVSKSKDPSGLLISVIRTLSTSDDVEDRENEKGRLEEA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EXOC4 Blocking Peptide, catalog no. 33R-5589, is also available for use as a blocking control in assays to test for specificity of this EXOC4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOC4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Sec8

Target: Sec8 (EXOC4) (Exocyst Complex Component 4 (EXOC4))

Alternative Name: EXOC4 (EXOC4 Products)

Synonyms: CG2095 antibody, Dmel\\CG2095 antibody, Sec8 antibody, Sec8p antibody, dsec8 antibody, fun antibody, SEC8L1 antibody, DKFZp459N1430 antibody, SEC8 antibody, C78892 antibody, Sec8l1 antibody, ALR antibody, si:ch211-92l17.2 antibody, si:rp71-18a24.2 antibody, ATSEC8 antibody, SUBUNIT OF EXOCYST COMPLEX 8 antibody, subunit of exocyst complex 8 antibody, Secretory 8 antibody, exocyst complex component 4 antibody, exocyst complex component 4 L homeolog antibody, Exocyst complex component 4 antibody, subunit of exocyst complex 8 antibody, Sec8 antibody, EXOC4 antibody, CpipJ_CPIJ001354 antibody, Exoc4 antibody, exoc4 antibody, exoc4.L antibody, sec-8 antibody, SEC8 antibody

Background: The protein encoded by this gene is a component of the exocyst complex, a multiple protein complex essential for targeting exocytic vesicles to specific docking sites on the plasma membrane. Though best characterized in yeast, the component proteins and functions of exocyst complex have been demonstrated to be highly conserved in higher eukaryotes.

Molecular Weight: 54 kDa (MW of target protein)

Pathways: Peptide Hormone Metabolism, Synaptic Vesicle Exocytosis