B3GNT4 antibody (N-Term)
-
- Target See all B3GNT4 Antibodies
- B3GNT4 (beta-1,3-N-Acetylglucosaminyltransferase 4 (B3GNT4))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This B3GNT4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- B3 GNT4 antibody was raised against the N terminal of B3 NT4
- Purification
- Affinity purified
- Immunogen
- B3 GNT4 antibody was raised using the N terminal of B3 NT4 corresponding to a region with amino acids MLPPQPSAAHQGRGGRSGLLPKGPAMLCRLCWLVSYSLAVLLLGCLLFLR
- Top Product
- Discover our top product B3GNT4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
B3GNT4 Blocking Peptide, catalog no. 33R-6200, is also available for use as a blocking control in assays to test for specificity of this B3GNT4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of B0 NT4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- B3GNT4 (beta-1,3-N-Acetylglucosaminyltransferase 4 (B3GNT4))
- Alternative Name
- B3GNT4 (B3GNT4 Products)
- Background
- B3GNT4 is a member of the beta-1,3-N-acetylglucosaminyltransferase protein family. The protein is involved in the biosynthesis of poly-N-acetyllactosamine chains and prefers lacto-N-neotetraose as a substrate. It is a type II transmembrane protein.
- Molecular Weight
- 42 kDa (MW of target protein)
-