TNKS antibody (Middle Region)

Catalog No. ABIN631422

Product Details anti-TNKS Antibody

Target: TNKS (Tankyrase, TRF1-Interacting Ankyrin-Related ADP-Ribose Polymerase (TNKS))

Binding Specificity: Middle Region

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TNKS antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TNKS antibody was raised against the middle region of TNKS

Purification: Affinity purified

Immunogen: TNKS antibody was raised using the middle region of TNKS corresponding to a region with amino acids LIKGVERLLGGQQGTNPYLTFHCVNQGTILLDLAPEDKEYQSVEEEMQST

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TNKS Blocking Peptide, catalog no. 33R-5048, is also available for use as a blocking control in assays to test for specificity of this TNKS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNKS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TNKS

Target: TNKS (Tankyrase, TRF1-Interacting Ankyrin-Related ADP-Ribose Polymerase (TNKS))

Alternative Name: TNKS (TNKS Products)

Synonyms: wu:fe02c12 antibody, ARTD5 antibody, PARP-5a antibody, PARP5A antibody, PARPL antibody, TIN1 antibody, TINF1 antibody, TNKS1 antibody, pART5 antibody, 4930554K12Rik antibody, AI662855 antibody, C86528 antibody, D130072O21Rik antibody, TANK1 antibody, mTNKS1 antibody, tankyrase-1 antibody, tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase b antibody, tankyrase antibody, tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase antibody, tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase 2 S homeolog antibody, tnksb antibody, TNKS antibody, Tnks antibody, tnks2.S antibody

Background: TNKS may regulate vesicle trafficking and modulate the subcellular distribution of SLC2A4/GLUT4-vesicles. It has PARP activity and can modify TERF1, and thereby contribute to the regulation of telomere length.

Molecular Weight: 142 kDa (MW of target protein)