Copine IV antibody (N-Term)

Catalog No. ABIN631417

Product Details anti-Copine IV Antibody

Target: Copine IV (CPNE4)

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Copine IV antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Copine IV antibody was raised against the N terminal of CPNE4

Purification: Affinity purified

Immunogen: Copine IV antibody was raised using the N terminal of CPNE4 corresponding to a region with amino acids EADFLGGMECTLGQIVSQRKLSKSLLKHGNTAGKSSITVIAEELSGNDDY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Copine IV Blocking Peptide, catalog no. 33R-2252, is also available for use as a blocking control in assays to test for specificity of this Copine IV antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPNE4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Copine IV

Target: Copine IV (CPNE4)

Alternative Name: Copine IV (CPNE4 Products)

Synonyms: CPNE4 antibody, COPN4 antibody, CPN4 antibody, 3632411M23Rik antibody, 4933406O10Rik antibody, si:dkey-5n4.1 antibody, copine 4 antibody, copine IV antibody, copine IVb antibody, CPNE4 antibody, cpne4 antibody, Cpne4 antibody, cpne4b antibody

Background: Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene is one of several genes that encode a calcium-dependent protein containing two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus. Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm.

Molecular Weight: 62 kDa (MW of target protein)