AMOTL1 antibody (N-Term)

Catalog No. ABIN631414

Product Details anti-AMOTL1 Antibody

Target: AMOTL1 (Angiomotin Like 1 (AMOTL1))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AMOTL1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: AMOTL1 antibody was raised against the N terminal of AMOTL1

Purification: Affinity purified

Immunogen: AMOTL1 antibody was raised using the N terminal of AMOTL1 corresponding to a region with amino acids LTQEDPQMVYQSARQEPQGQEHQVDNTVMEKQVRSTQPQQNNEELPTYEE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AMOTL1 Blocking Peptide, catalog no. 33R-5487, is also available for use as a blocking control in assays to test for specificity of this AMOTL1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AMOTL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AMOTL1

Target: AMOTL1 (Angiomotin Like 1 (AMOTL1))

Alternative Name: AMOTL1 (AMOTL1 Products)

Synonyms: JEAP antibody, 2310010G08Rik antibody, 2310067L22Rik antibody, 4932416D09Rik antibody, mFLJ00155 antibody, angiomotin like 1 antibody, angiomotin-like 1 antibody, AMOTL1 antibody, Amotl1 antibody

Background: AMOTL1 is a peripheral membrane protein that is a component of tight junctions or TJs. TJs form an apical junctional structure and act to control paracellular permeability and maintain cell polarity. This protein is related to angiomotin, an angiostatin binding protein that regulates endothelial cell migration and capillary formation.

Molecular Weight: 106 kDa (MW of target protein)