VPS37A antibody
-
- Target See all VPS37A Antibodies
- VPS37A (Vacuolar Protein Sorting 37 Homolog A (VPS37A))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This VPS37A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- VPS37 A antibody was raised using a synthetic peptide corresponding to a region with amino acids SWLFPLTKSASSSAAGSPGGLTSLQQQKQRLIESLRNSHSSIAEIQKDVE
- Top Product
- Discover our top product VPS37A Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
VPS37A Blocking Peptide, catalog no. 33R-8941, is also available for use as a blocking control in assays to test for specificity of this VPS37A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VPS30 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- VPS37A (Vacuolar Protein Sorting 37 Homolog A (VPS37A))
- Alternative Name
- VPS37A (VPS37A Products)
- Synonyms
- fb08f03 antibody, fj42c03 antibody, zgc:73244 antibody, zgc:77637 antibody, wu:fb08f03 antibody, wu:fj42c03 antibody, HCRP1 antibody, PQBP2 antibody, SPG53 antibody, 2210018P21Rik antibody, 4930592A21Rik antibody, AW261445 antibody, D8Ertd531e antibody, vacuolar protein sorting 37A antibody, VPS37A, ESCRT-I subunit antibody, vacuolar protein sorting 37 homolog A antibody, vacuolar protein sorting 37 homolog A L homeolog antibody, vps37a antibody, VPS37A antibody, vps37a.L antibody, Vps37a antibody
- Background
- VPS37A is a component of the ESCRT-I complex, a regulator of vesicular trafficking process. Required for the sorting of endocytic ubiquitinated cargos into multivesicular bodies. VPS37A may be involved in cell growth and differentiation.
- Molecular Weight
- 44 kDa (MW of target protein)
-