TRMT61A antibody (N-Term)

Catalog No. ABIN631401

Product Details anti-TRMT61A Antibody

Target: TRMT61A (tRNA Methyltransferase 61 Homolog A (TRMT61A))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TRMT61A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C14 ORF172 antibody was raised against the N terminal Of C14 rf172

Purification: Affinity purified

Immunogen: C14 ORF172 antibody was raised using the N terminal Of C14 rf172 corresponding to a region with amino acids MSFVAYEELIKEGDTAILSLGHGAMVAVRVQRGAQTQTRHGVLRHSVDLI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C14ORF172 Blocking Peptide, catalog no. 33R-6422, is also available for use as a blocking control in assays to test for specificity of this C14ORF172 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF172 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TRMT61A

Target: TRMT61A (tRNA Methyltransferase 61 Homolog A (TRMT61A))

Alternative Name: C14ORF172 (TRMT61A Products)

Synonyms: C14orf172 antibody, GCD14 antibody, Gcd14p antibody, TRM61 antibody, hTRM61 antibody, Gcd14 antibody, RGD1359191 antibody, Trm61 antibody, 6720458F09Rik antibody, AI606093 antibody, zgc:86657 antibody, tRNA methyltransferase 61A antibody, TRMT61A antibody, Trmt61a antibody, trmt61a antibody

Background: The function of Chromosome 14 ORF protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 31 kDa (MW of target protein)