PNPLA5 antibody (C-Term)

Catalog No. ABIN631400

Product Details anti-PNPLA5 Antibody

Target: PNPLA5 (Patatin-Like phospholipase Domain Containing 5 (PNPLA5))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PNPLA5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PNPLA5 antibody was raised against the C terminal of PNPLA5

Purification: Affinity purified

Immunogen: PNPLA5 antibody was raised using the C terminal of PNPLA5 corresponding to a region with amino acids NMALEVFSRTKAQLLGPISPPATRVLETSPLQPQIAPHREELGPTHQA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PNPLA5 Blocking Peptide, catalog no. 33R-6789, is also available for use as a blocking control in assays to test for specificity of this PNPLA5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNPLA5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PNPLA5

Target: PNPLA5 (Patatin-Like phospholipase Domain Containing 5 (PNPLA5))

Alternative Name: PNPLA5 (PNPLA5 Products)

Synonyms: GS2L antibody, dJ388M5 antibody, dJ388M5.4 antibody, 4833426H19Rik antibody, patatin like phospholipase domain containing 5 antibody, patatin-like phospholipase domain containing 5 antibody, PNPLA5 antibody, Pnpla5 antibody

Background: Human patatin-like phospholipases, such as PNPLA5, have been implicated in regulation of adipocyte differentiation and have been induced by metabolic stimuli.

Molecular Weight: 48 kDa (MW of target protein)