RNF169 antibody (N-Term)

Catalog No. ABIN631397

Product Details anti-RNF169 Antibody

Target: RNF169 (Ring Finger Protein 169 (RNF169))

Binding Specificity: N-Term

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RNF169 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RNF169 antibody was raised against the N terminal of RNF169

Purification: Affinity purified

Immunogen: RNF169 antibody was raised using the N terminal of RNF169 corresponding to a region with amino acids DTETGKRKMDEQKKRDEPLVLKTNLERCPARLSDSENEEPSRGQMTQTHR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RNF169 Blocking Peptide, catalog no. 33R-2192, is also available for use as a blocking control in assays to test for specificity of this RNF169 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF169 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RNF169

Target: RNF169 (Ring Finger Protein 169 (RNF169))

Alternative Name: RNF169 (RNF169 Products)

Synonyms: 2900057K09Rik antibody, ring finger protein 169 antibody, RNF169 antibody, Rnf169 antibody

Background: The function of RNF169 has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 77 kDa (MW of target protein)