HECTD2 antibody (C-Term)

Catalog No. ABIN631394

Product Details anti-HECTD2 Antibody

Target: HECTD2 (HECT Domain Containing 2 (HECTD2))

Binding Specificity: C-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HECTD2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: HECTD2 antibody was raised against the C terminal of HECTD2

Purification: Affinity purified

Immunogen: HECTD2 antibody was raised using the C terminal of HECTD2 corresponding to a region with amino acids TDLTIKYFWDVVLGFPLDLQKKLLHFTTGSDRVPVGGMADLNFKISKNET

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HECTD2 Blocking Peptide, catalog no. 33R-9013, is also available for use as a blocking control in assays to test for specificity of this HECTD2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HECTD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HECTD2

Target: HECTD2 (HECT Domain Containing 2 (HECTD2))

Alternative Name: HECTD2 (HECTD2 Products)

Synonyms: hmm77879 antibody, HECTD2 antibody, DKFZp459J1430 antibody, 4921524L07 antibody, A630025O09Rik antibody, AW212605 antibody, HECT domain E3 ubiquitin protein ligase 2 antibody, HECT domain containing E3 ubiquitin protein ligase 2 antibody, Probable E3 ubiquitin-protein ligase HECTD2 antibody, HECT domain containing 2 antibody, HECTD2 antibody, hectd2 antibody, hecd2 antibody, Hectd2 antibody

Background: HECTD2 is a probable E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates.

Molecular Weight: 88 kDa (MW of target protein)